- SCARA5 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83572
- Immunohistochemistry, Immunohistochemistry-Paraffin
- NET33, Tesr
- Human
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- scavenger receptor class A member 5
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- This antibody was developed against Recombinant Protein corresponding to amino acids: PDDLKALTRN VNRLNESFRD LQLRLLQAPL QADLTEQVWK VQDALQNQSD SLLALAGAVQ RLE
- SCARA5
- Rabbit
- 0.1 ml (also 25ul)
Sequence
PDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLTEQVWKVQDALQNQSDSLLALAGAVQRLE
Specifications/Features
Available conjugates: Unconjugated